PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_77637.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HB-PHD
Protein Properties Length: 828aa    MW: 91098 Da    PI: 6.2127
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_77637.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.66.5e-115956341352
                   HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
      Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                   + L+++Fek++yps+ ++e LA++lgLt  qV+ WF   R
  MLOC_77637.1 595 QKLKAYFEKEPYPSRPAKESLAQELGLTFHQVTRWFSSTR 634
                   78**********************************8776 PP

2PHD42.12e-14241296151
                   SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
           PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                   +C++C +   + +++++lCdg C++ fH+kCl+++l  e++p+g   wlC+ C++k
  MLOC_77637.1 241 FCAICASkhVTLKNDIILCDGvCDRGFHQKCLNPPLLAEDIPQGdeGWLCPACDCK 296
                   7******65555********77*********************999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579034.21E-14231299IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.7E-13237296IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.021239296IPR019787Zinc finger, PHD-finger
SMARTSM002492.5E-10241294IPR001965Zinc finger, PHD-type
CDDcd155041.35E-25241293No hitNo description
PfamPF006281.6E-11241296IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590242293IPR019786Zinc finger, PHD-type, conserved site
SuperFamilySSF466896.84E-11579638IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-11580634IPR009057Homeodomain-like
PROSITE profilePS5007113.167580640IPR001356Homeobox domain
SMARTSM003895.7E-11583644IPR001356Homeobox domain
CDDcd000861.38E-10585638No hitNo description
PfamPF000462.4E-8595634IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MDKTSASGLV QENKKVGNDS SSPPTKGKRG RKGSQITASK KYLRRSAHSS ARVLRSTSKD  60
KSKTPNEPVS PLRSAHSSPR VLRSTPKNKS KTPKKQVNSS RSTRSSARAL SSTLKKKAPN  120
EPVNDSTAAQ PAARKRKRGR PSNAANPKNE CIKIRQRVRY ILNRMNYEQS FIQAYAGEGW  180
KGQSLEKIRP EKELERAKAE ILRCKLRIRE AFRNMDSLLL EGKLDESLFD SEGEISSEDI  240
FCAICASKHV TLKNDIILCD GVCDRGFHQK CLNPPLLAED IPQGDEGWLC PACDCKLDCI  300
DLLNELQGST LAIHDSWEEV FPESTSNGLE QIGASDLPSD DSEEDYDPTL AERGMEDGNK  360
SSAEDVDEGS DSDDLDFITS SDESEPSKKK KSESNNKNTV NDLELPSDDS EDDDFDPEGR  420
NSSEDQKAKT NSDESDFTSD SDDFCAEISK SCGKDEVLAP SFADPTAGVD IMEAELEQDS  480
VLPSSSRRQV GRLNYKKLYD EAYGKETTDS SDEEEWSGHS TCPNGNPEDS DTDSLAGSLK  540
PAKTRRARGG RQNNERTPQS ERHSGSVSEQ HPEVLHSNGT SSTARKKRYG PIVNQKLKAY  600
FEKEPYPSRP AKESLAQELG LTFHQVTRWF SSTRHYSRAT GAKKGKRPEN YTAENNDGIA  660
ADSIQQREPS GSVLEKPTVG RNGIVSEERM TQNNLDEGEK DINGEQTLDM TPTANKHNTT  720
KNSRDVDSPI GAPGGNQQSG TSRNAEDIQD IGCEQTVATV NQNCTINSNN VGSPKDVSGG  780
NHRLNSPKIV GSPRRRSAGK NIPGLEHVDE ARRKAILQEL RRMKAAGR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114136KKKAPNEPVNDSTAAQPAARKRK
2132138ARKRKRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2517010.0AK251701.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf120a17, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569804.10.0PREDICTED: homeobox protein HOX1A-like isoform X2
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLM0Z5V70.0M0Z5V7_HORVD; Uncharacterized protein
STRINGMLOC_77637.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-80Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain